Table Of Contents

Next topic

Contents

This Page

MView

MView reformats the results of a sequence database search (BLAST, FASTA, etc) or a multiple alignment (MSF, PIR, CLUSTAL, etc) adding optional HTML markup to control colouring and web page layout. It can also be used as a filter to extract and convert searches or alignments to common formats.

                      1 [        .         .         .         .         :         .         .         ] 80
1 EGFR          100.0%  FKKIKVLGSGAFGTVYKGLWIPEGEK---------VKIPVAIKELREATSPK-ANKEILDEAYVMASVDNPHVCRLLGIC
2 DMDPR2         35.7%  ISVNKQLGTGEFGIVQQGVWSNGNE-----------RIQVAIKCLCRERMQS-NPMEFLKEAAIMHSIEHENIVRLYGVV
3 ITK_HUMAN      32.9%  LTFVQEIGSGQFGLVHLGYWLN--------------KDKVAIKTIREGAMS---EEDFIEEAEVMMKLSHPKLVQLYGVC
4 GCTK2ID        21.2%  IREVKQIGVGQFGAVVLAEMTGLS-XLPKGSMNADGVALVAVKKLKPDVSD-EVLQSFDKEIKFMSQLQHDSIVQLLAIC
5 CEC55C3        31.5%  VELTKKLGEGAFGEVWKGKLLKILDA-------NHQPVLVAVKTAKLESMTKEQIKEIMREARLMRNLDHINVVKFFGVA
  consensus/90%         .......G.G.FG.V........................VA.K.................E...M...............
  consensus/80%         ....K..G.G.FG.V..G.....................VA.K.................EA..M....H...V.L.G..

MView is implemented in Perl as a self-contained command line program that should run cross-platform.

Documentation

Main topics:

The full documentation tree is here:

Download

The latest version of the software can be downloaded from the SourceForge MView project as a UNIX/Linux gzipped or bzipped tar archive.